HOXB1 antibody (AA 176-220)

Catalog No. ABIN5647148

This anti-HOXB1 antibody is a Rabbit Polyclonal antibody detecting HOXB1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for HOXB1 antibody (AA 176-220) (ABIN5647148)

Target: HOXB1 (Homeobox B1 (HOXB1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HOXB1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HOXB1 Antibody

Binding Specificity: AA 176-220

Purification: Antigen affinity purified

Immunogen: Amino acids 176-220 (TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK) were used as the immunogen for the HOXB1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the HOXB1 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the HOXB1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for HOXB1

Target: HOXB1 (Homeobox B1 (HOXB1))

Alternative Name: HOXB1

Background: Homeobox protein Hox-B1 is a protein that in humans is encoded by the HOXB1 gene. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.

UniProt: P14653