XPO5 antibody (AA 2-43)

Catalog No. ABIN5647153

The Rabbit Polyclonal anti-XPO5 antibody has been validated for WB. It is suitable to detect XPO5 in samples from Human, Mouse and Rat.

Quick Overview for XPO5 antibody (AA 2-43) (ABIN5647153)

Target: XPO5 (Exportin 5 (XPO5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XPO5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-XPO5 Antibody

Binding Specificity: AA 2-43

Purification: Antigen affinity purified

Immunogen: Amino acids 2-43 (AMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEK) were used as the immunogen for the Exportin-5 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Exportin-5 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Exportin-5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for XPO5

Target: XPO5 (Exportin 5 (XPO5))

Alternative Name: Exportin-5

Background: Exportin-5 (XPO5) is a protein that in humans is encoded by the XPO5 gene. The International Radiation Hybrid Mapping Consortium mapped the XPO5 gene to chromosome 6. This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process.

UniProt: Q9HAV4

Pathways: Regulatory RNA Pathways, Protein targeting to Nucleus