MC3R antibody (AA 91-121)

Catalog No. ABIN5647192

The Rabbit Polyclonal anti-MC3R antibody has been validated for WB. It is suitable to detect MC3R in samples from Human and Mouse.

Quick Overview for MC3R antibody (AA 91-121) (ABIN5647192)

Target: MC3R (Melanocortin 3 Receptor (MC3R))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MC3R antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MC3R Antibody

Binding Specificity: AA 91-121

Purification: Antigen affinity purified

Immunogen: Amino acids 91-121 (NALETIMIAIVHSDYLTFEDQFIQHMDNIFD) from the human protein were used as the immunogen for the MC3 Receptor antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the MC3 Receptor antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the MC3 Receptor antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for MC3R

Target: MC3R (Melanocortin 3 Receptor (MC3R))

Alternative Name: MC3R / MC3 Receptor

Background: Melanocortin receptor 3 is a protein that in humans is encoded by the MC3R gene. It is mapped to 20q13.2. This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans.

UniProt: P41968

Pathways: cAMP Metabolic Process