Myoglobin antibody (AA 3-35)

Catalog No. ABIN5647210

The Rabbit Polyclonal anti-Myoglobin antibody has been validated for WB. It is suitable to detect Myoglobin in samples from Human.

Quick Overview for Myoglobin antibody (AA 3-35) (ABIN5647210)

Target: Myoglobin (MB)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Myoglobin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Myoglobin Antibody

Binding Specificity: AA 3-35

Purification: Antigen affinity purified

Immunogen: Amino acids 3-35 (LSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFK) were used as the immunogen for the Myoglobin antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Myoglobin antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Myoglobin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Myoglobin

Target: Myoglobin (MB)

Alternative Name: Myoglobin

Background: Myoglobin (MB) also known as PVALB, is a single-chain globular protein of 153 or 154 amino acids, containing a heme (iron-containing porphyrin) prosthetic group in the center around which the remaining apoprotein folds. It is a member of the globin superfamily and is expressed in skeletal and cardiac muscles. This gene is mapped to chromosome 22q11-q13. Myoglobin is released from damaged muscle tissue (rhabdomyolysis), which has very high concentrations of myoglobin. The released myoglobin is filtered by the kidneys but is toxic to the renal tubular epithelium and so may cause acute renal failure.

UniProt: P02144

Pathways: Brown Fat Cell Differentiation