RANBP2 antibody (AA 3018-3057)

Catalog No. ABIN5647220

This anti-RANBP2 antibody is a Rabbit Polyclonal antibody detecting RANBP2 in WB. Suitable for Mouse and Rat.

Quick Overview for RANBP2 antibody (AA 3018-3057) (ABIN5647220)

Target: RANBP2 (RAN Binding Protein 2 (RANBP2))

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RANBP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RANBP2 Antibody

Binding Specificity: AA 3018-3057

Cross-Reactivity (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogen: Amino acids 3018-3057 (EQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAE) were used as the immunogen for the RanBP2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the RanBP2 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the RanBP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for RANBP2

Target: RANBP2 (RAN Binding Protein 2 (RANBP2))

Alternative Name: RanBP2

Background: RAN binding protein 2 (RANBP2), also called NUP358 is protein which in humans is encoded by the RANBP2 gene. This gene encodes a very large RAN-binding protein that immunolocalizes to the nuclear pore complex. The protein is a giant scaffold and mosaic cyclophilin-related nucleoporin implicated in the Ran-GTPase cycle. And the encoded protein directly interacts with the E2 enzyme UBC9 and strongly enhances SUMO1 transfer from UBC9 to the SUMO1 target SP100. These findings place sumoylation at the cytoplasmic filaments of the nuclear pore complex and suggest that, for some substrates, modification and nuclear import are linked events. This gene is partially duplicated in a gene cluster that lies in a hot spot for recombination on chromosome 2q.

UniProt: P49792

Pathways: Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Protein targeting to Nucleus