SAFB antibody (AA 715-754)

Catalog No. ABIN5647265

This anti-SAFB antibody is a Rabbit Polyclonal antibody detecting SAFB in WB. Suitable for Human.

Quick Overview for SAFB antibody (AA 715-754) (ABIN5647265)

Target: SAFB (Scaffold Attachment Factor B (SAFB))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SAFB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SAFB Antibody

Binding Specificity: AA 715-754

Purification: Antigen affinity purified

Immunogen: Amino acids 715-754 (DLDRRDDAYWPEAKRAALDERYHSDFNRQDRFHDFDHRDR) from the human protein were used as the immunogen for the SAFB antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the SAFB antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for SAFB

Target: SAFB (Scaffold Attachment Factor B (SAFB))

Alternative Name: SAFB / Scaffold attachment factor B1

Background: Scaffold attachment factor B, also known as SAFB, is a gene with homologs that have been studied in humans and mice. This gene encodes a DNA-binding protein which has high specificity for scaffold or matrix attachment region DNA elements (S/MAR DNA). This protein is thought to be involved in attaching the base of chromatin loops to the nuclear matrix but there is conflicting evidence as to whether this protein is a component of chromatin or a nuclear matrix protein. Scaffold attachment factors are a specific subset of nuclear matrix proteins (NMP) that specifically bind to S/MAR. The encoded protein is thought to serve as a molecular base to assemble a 'transcriptosome complex' in the vicinity of actively transcribed genes. It is involved in the regulation of heat shock protein 27 transcription, can act as an estrogen receptor co-repressor and is a candidate for breast tumorigenesis. This gene is arranged head-to-head with a similar gene whose product has the same functions. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: Q15424

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway