SYN1 antibody (AA 662-705)

Catalog No. ABIN5647272

This Rabbit Polyclonal antibody specifically detects SYN1 in WB and IHC (p). It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for SYN1 antibody (AA 662-705) (ABIN5647272)

Target: SYN1 (Synapsin I (SYN1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SYN1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-SYN1 Antibody

Binding Specificity: AA 662-705

Purification: Antigen affinity purified

Immunogen: Amino acids 662-705 (KSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASLFSD) from the human protein were used as the immunogen for the Synapsin 1 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Synapsin 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for SYN1

Target: SYN1 (Synapsin I (SYN1))

Alternative Name: Synapsin 1

Background: Synapsin I, is the collective name for Synapsin Ia and Synapsin Ib, two nearly identical phosphoproteins that in humans are encoded by the SYN1 gene. This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family plays a role in regulation of axonogenesis and synaptogenesis. The protein encoded serves as a substrate for several different protein kinases and phosphorylation may function in the regulation of this protein in the nerve terminal. Mutations in this gene may be associated with X-linked disorders with primary neuronal degeneration such as Rett syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.

UniProt: P17600