Thioredoxin-Like 4A (TXNL4A) (AA 1-142) antibody Primary Antibody
TXNL4A
Reactivity: Human
ELISA, WB
Host: Mouse
Monoclonal
1C4
camera_alt 3
Catalog No. ABIN564731
$440.00
Plus shipping costs $45.00
100 μg
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 1-142
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Monoclonal
- Conjugate
- Un-conjugated
- Application
- ELISA, Western Blotting (WB)
- Purpose
- Mouse monoclonal antibody raised against a full length recombinant TXNL4A.
- Cross-Reactivity
- Human
- Immunogen
immunogen: TXNL4A (AAH01046, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence: MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
- Clone
- 1C4
- Isotype
- IgG1 kappa
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- TXNL4A (TXNL4A Antibody Abstract)
- Synonyms
- Txnl4, TXNL4A, txnl4a, dim1, MGC85128, DIB1, DIM1, HsT161, SNRNP15, TXNL4, U5-15kD, D18Wsu98e, Dim1, ENSMUSG00000057130, U5-15kDa, thioredoxin-like 4A, thioredoxin like 4A, thioredoxin like 4A S homeolog, Txnl4a, TXNL4A, txnl4a, LOC664328, txnl4a.S
- Background
- Full Gene Name: thioredoxin-like 4A
Synonyms: DIB1,DIM1,HsT161,TXNL4,U5-15kD - Gene ID
- 10907
- Pathways
- Ribonucleoprotein Complex Subunit Organization
You are here: