TFPI2 antibody (AA 70-105)

Catalog No. ABIN5647314

This Rabbit Polyclonal antibody specifically detects TFPI2 in WB and IHC (p). It exhibits reactivity toward Human and Mouse.

Quick Overview for TFPI2 antibody (AA 70-105) (ABIN5647314)

Target: TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TFPI2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-TFPI2 Antibody

Binding Specificity: AA 70-105

Purification: Antigen affinity purified

Immunogen: Amino acids 70-105 (EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ) from the human protein were used as the immunogen for the TFPI2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the TFPI2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the TFPI2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for TFPI2

Target: TFPI2 (Tissue Factor Pathway Inhibitor 2 (TFPI2))

Alternative Name: TFPI2

Background: Tissue factor pathway inhibitor 2, also known as TFPI2, is a human gene which is located at 7q22. It is an important regulator of the extrinsic pathway of blood coagulation through its ability to inhibit factor Xa and factor VIIa-tissue factor activity. After a 22-residue signal peptide, the mature TFPI2 protein contains 213 amino acids with 18 cysteines and 2 canonical N-linked glycosylation sites. The purified recombinant TFPI2 strongly inhibited the amidolytic activities of trypsin and the factor VIIa-tissue factor complex. The latter inhibition was markedly enhanced in the presence of heparin. Mouse TFPI2 mRNA is highly expressed in developing mouse placenta, as in human. And there are also high transcript levels in adult mouse liver and kidney.

UniProt: P48307