LMO1 antibody (AA 127-156)

Catalog No. ABIN5647374

This Rabbit Polyclonal antibody specifically detects LMO1 in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for LMO1 antibody (AA 127-156) (ABIN5647374)

Target: LMO1 (LIM Domain Only 1 (Rhombotin 1) (LMO1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LMO1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LMO1 Antibody

Binding Specificity: AA 127-156

Purification: Antigen affinity purified

Immunogen: Amino acids 127-156 (DKFFLKNNMILCQMDYEEGQLNGTFESQVQ) from the human protein were used as the immunogen for the LMO1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the LMO1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the LMO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for LMO1

Target: LMO1 (LIM Domain Only 1 (Rhombotin 1) (LMO1))

Alternative Name: LMO1

Background: Rhombotin-1 is a protein that in humans is encoded by the LMO1 gene. This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions, thus the encoded protein may regulate transcription by competitively binding to specific DNA-binding transcription factors. Alterations at this locus have been associated with acute lymphoblastic T-cell leukemia. Chromosomal rearrangements have been observed between this locus and at least two loci, the delta subunit of the T-cell antigen receptor gene and the LIM domain binding 1 gene. Alternatively spliced transcript variants have been described.

UniProt: P25800

Pathways: Dopaminergic Neurogenesis