ANGPTL4 antibody (AA 369-406)

Catalog No. ABIN5647464

This Rabbit Polyclonal antibody specifically detects ANGPTL4 in WB and ELISA. It exhibits reactivity toward Human.

Quick Overview for ANGPTL4 antibody (AA 369-406) (ABIN5647464)

Target: ANGPTL4 (Angiopoietin-Like 4 (ANGPTL4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANGPTL4 antibody is un-conjugated

Application: Western Blotting (WB), ELISA

Product Details anti-ANGPTL4 Antibody

Binding Specificity: AA 369-406

Purification: Antigen affinity purified

Immunogen: Amino acids 369-406 (QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS) from the human protein were used as the immunogen for the ANGPTL4 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ANGPTL4 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,ELISA: 0.1-0.5 μg/mL (human protein tested, request BSA-free format for coating)

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ANGPTL4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ANGPTL4

Target: ANGPTL4 (Angiopoietin-Like 4 (ANGPTL4))

Alternative Name: ANGPTL4

Background: Angiopoietin-related protein 4 (Angptl4) is a protein that in humans is encoded by the ANGPTL4 gene. This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. And this gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. By radiation hybrid analysis, Angptl4 gene is mapped to 19p13.3. ANGPTL4 contributed to tumor growth and protected cells from anoikis, a form of programmed cell death induced when contact-dependent cells detach from the surrounding tissue matrix.

UniProt: Q9BY76

Pathways: Regulation of Lipid Metabolism by PPARalpha