CCDC6 antibody (AA 156-198)

Catalog No. ABIN5647505

This anti-CCDC6 antibody is a Rabbit Polyclonal antibody detecting CCDC6 in WB. Suitable for Human and Rat.

Quick Overview for CCDC6 antibody (AA 156-198) (ABIN5647505)

Target: CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CCDC6 Antibody

Binding Specificity: AA 156-198

Purification: Antigen affinity purified

Immunogen: Amino acids 156-198 (KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRRE) from the human protein were used as the immunogen for the CCDC6 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the CCDC6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for CCDC6

Target: CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))

Alternative Name: CCDC6

Background: Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.

UniProt: Q16204