Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

DC-SIGN/CD209 antibody

CD209 Reactivity: Human, Mouse, Rat WB, FACS, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5647543
  • Target See all DC-SIGN/CD209 (CD209) Antibodies
    DC-SIGN/CD209 (CD209) (CD209)
    Reactivity
    • 84
    • 25
    • 19
    • 1
    Human, Mouse, Rat
    Host
    • 64
    • 35
    • 2
    • 1
    Rabbit
    Clonality
    • 62
    • 40
    Polyclonal
    Conjugate
    • 55
    • 7
    • 4
    • 4
    • 4
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This DC-SIGN/CD209 antibody is un-conjugated
    Application
    • 64
    • 33
    • 32
    • 27
    • 24
    • 13
    • 7
    • 5
    • 5
    • 3
    • 3
    • 3
    • 2
    • 1
    Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purification
    Antigen affinity purified
    Immunogen
    Amino acids MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA were used as the immunogen for the DC-SIGN antibody.
    Isotype
    IgG
    Top Product
    Discover our top product CD209 Primary Antibody
  • Application Notes
    Optimal dilution of the DC-SIGN antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL,FACS: 1-3 μg/10^6 cells
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Storage
    -20 °C
    Storage Comment
    After reconstitution, the DC-SIGN antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target
    DC-SIGN/CD209 (CD209) (CD209)
    Alternative Name
    DC-SIGN / CD209 (CD209 Products)
    Background
    DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin) also known as CD209 (Cluster of Differentiation 209) is a protein which in humans is encoded by the CD209 gene. This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene. DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.
    UniProt
    Q9NNX6
You are here:
Chat with us!