DVL2 antibody (AA 35-64)
-
- Target See all DVL2 Antibodies
- DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))
-
Binding Specificity
- AA 35-64
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DVL2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity purified
- Immunogen
- Amino acids 35-64 (AERITLGDFKSVLQRPAGAKYFFKSMDQDF) from the human protein were used as the immunogen for the Dishevelled 2 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product DVL2 Primary Antibody
-
-
- Application Notes
- Optimal dilution of the Dishevelled 2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the Dishevelled 2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))
- Alternative Name
- Dishevelled 2 / DVL2 (DVL2 Products)
- Synonyms
- Xdsh antibody, dishevelled antibody, dsh antibody, dvl antibody, Dvl-2 antibody, xdsh antibody, wu:fc05d12 antibody, wu:fo71e09 antibody, wu:fp54a02 antibody, zgc:55372 antibody, dishevelled segment polarity protein 2 antibody, dishevelled segment polarity protein 2 L homeolog antibody, DVL2 antibody, dvl2 antibody, Dvl2 antibody, dvl2.L antibody
- Background
- Segment polarity protein dishevelled homolog DVL-2 is a protein that in humans is encoded by the DVL2 gene. This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40 % amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.
- UniProt
- O14641
- Pathways
- Tube Formation
-