DVL2 antibody (AA 35-64)

Catalog No. ABIN5647553

Product Details anti-DVL2 Antibody

Target: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Binding Specificity: AA 35-64

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DVL2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 35-64 (AERITLGDFKSVLQRPAGAKYFFKSMDQDF) from the human protein were used as the immunogen for the Dishevelled 2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Dishevelled 2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Dishevelled 2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for DVL2

Target: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Alternative Name: Dishevelled 2 / DVL2 (DVL2 Products)

Synonyms: Xdsh antibody, dishevelled antibody, dsh antibody, dvl antibody, Dvl-2 antibody, xdsh antibody, wu:fc05d12 antibody, wu:fo71e09 antibody, wu:fp54a02 antibody, zgc:55372 antibody, dishevelled segment polarity protein 2 antibody, dishevelled segment polarity protein 2 L homeolog antibody, DVL2 antibody, dvl2 antibody, Dvl2 antibody, dvl2.L antibody

Background: Segment polarity protein dishevelled homolog DVL-2 is a protein that in humans is encoded by the DVL2 gene. This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40 % amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.

UniProt: O14641

Pathways: Tube Formation