GPI antibody (AA 2-39)

Catalog No. ABIN5647568

This anti-GPI antibody is a Rabbit Polyclonal antibody detecting GPI in WB. Suitable for Mouse.

Quick Overview for GPI antibody (AA 2-39) (ABIN5647568)

Target: GPI (Glucose-6-Phosphate Isomerase (GPI))

Reactivity: Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPI antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GPI Antibody

Binding Specificity: AA 2-39

Purification: Antigen affinity purified

Immunogen: Amino acids 2-39 (AALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNN) from the mouse protein were used as the immunogen for the Glucose-6-phosphate isomerase antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Glucose-6-phosphate isomerase antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for GPI

Target: GPI (Glucose-6-Phosphate Isomerase (GPI))

Alternative Name: GPI / Glucose-6-phosphate isomerase

Background: Glucose-6-phosphate isomerase (GPI), alternatively known as phosphoglucose isomerase (PGI) or phosphohexose isomerase (PHI), is an enzyme that in humans is encoded by the GPI gene on chromosome 19. This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants.

UniProt: P06745