GPI antibody (AA 5-39)

Catalog No. ABIN5647569

This Rabbit Polyclonal antibody specifically detects GPI in WB. It exhibits reactivity toward Human.

Quick Overview for GPI antibody (AA 5-39) (ABIN5647569)

Target: GPI (Glucose-6-Phosphate Isomerase (GPI))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPI antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GPI Antibody

Binding Specificity: AA 5-39

Purification: Antigen affinity purified

Immunogen: Amino acids 5-39 (TRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNH) from the human protein were used as the immunogen for the GPI antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the GPI antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for GPI

Target: GPI (Glucose-6-Phosphate Isomerase (GPI))

Alternative Name: GPI / Glucose-6-phosphate isomerase

Background: Glucose-6-phosphate isomerase (GPI), alternatively known as phosphoglucose isomerase (PGI) or phosphohexose isomerase(PHI), is an enzyme that in humans is encoded by the GPI gene on chromosome 19. This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants.

UniProt: P06744