ACADVL antibody (AA 538-576)

Catalog No. ABIN5647680

Product Details anti-ACADVL Antibody

Target: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Binding Specificity: AA 538-576

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACADVL antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 538-576 (RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY) from the human protein were used as the immunogen for the ACADVL antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ACADVL antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ACADVL

Target: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Alternative Name: ACADVL / VLCAD (ACADVL Products)

Synonyms: ACAD6 antibody, LCACD antibody, VLCAD antibody, vlcad antibody, fb52d04 antibody, wu:fb52d04 antibody, wu:fc75e01 antibody, zgc:64067 antibody, acyl-CoA dehydrogenase very long chain antibody, acyl-Coenzyme A dehydrogenase, very long chain antibody, acyl-CoA dehydrogenase, very long chain antibody, ACADVL antibody, Acadvl antibody, acadvl antibody

Background: Very long-chain specific acyl-CoA dehydrogenase, mitochondrial (VLCAD) is an enzyme that in humans is encoded by the ACADVL gene. The protein encoded by this gene is targeted to the inner mitochondrial membrane, where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenaseis specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.

UniProt: P49748

Pathways: ER-Nucleus Signaling, Monocarboxylic Acid Catabolic Process