ACADVL antibody (AA 538-576)

Catalog No. ABIN5647680

This Rabbit Polyclonal antibody specifically detects ACADVL in WB, IF, IP, FACS and IHC (p). It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ACADVL antibody (AA 538-576) (ABIN5647680)

Target: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACADVL antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF), Immunoprecipitation (IP), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-ACADVL Antibody

Binding Specificity: AA 538-576

Purpose: ACADVL Antibody / VLCAD

Sequence: RALEQFATVV EAKLIKHKKG IVNEQFLLQR LADGAIDLY

Purification: Antigen affinity

Immunogen: Amino acids 538-576 (RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY) from the human protein were used as the immunogen for the ACADVL antibody.

Isotype: IgG

Application Details

Application Notes: Differences in protocols and secondary/substrate sensitivity may require the ACADVL antibody to be titrated for optimal performance.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the ACADVL antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for ACADVL

Target: ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))

Alternative Name: ACADVL

Background: Very long-chain specific acyl-CoA dehydrogenase, mitochondrial (VLCAD) is an enzyme that in humans is encoded by the ACADVL gene. The protein encoded by this gene is targeted to the inner mitochondrial membrane, where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenaseis specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.

UniProt: P49748

Pathways: ER-Nucleus Signaling, Monocarboxylic Acid Catabolic Process