ASXL1 antibody

Catalog No. ABIN5647693

The Rabbit Polyclonal anti-ASXL1 antibody has been validated for WB. It is suitable to detect ASXL1 in samples from Human and Mouse.

Quick Overview for ASXL1 antibody (ABIN5647693)

Target: ASXL1 (Additional Sex Combs Like 1 (ASXL1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASXL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ASXL1 Antibody

Purification: Antigen affinity purified

Immunogen: Amino acids KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE were used as the immunogen for the ASXL1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ASXL1 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ASXL1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ASXL1

Target: ASXL1 (Additional Sex Combs Like 1 (ASXL1))

Alternative Name: ASXL1

Background: Putative Polycomb group protein ASXL1 is a protein that in humans is encoded by the ASXL1 gene. This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants.

UniProt: Q8IXJ9

Pathways: Retinoic Acid Receptor Signaling Pathway