OTC antibody (AA 33-70)

Catalog No. ABIN5647747

Product Details anti-OTC Antibody

Target: OTC (Ornithine Carbamoyltransferase (OTC))

Binding Specificity: AA 33-70

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OTC antibody is un-conjugated

Application: Western Blotting (WB)

Cross-Reactivity (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogen: Amino acids 33-70 (NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK) from the human protein were used as the immunogen for the OTC antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the OTC antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the OTC antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for OTC

Target: OTC (Ornithine Carbamoyltransferase (OTC))

Alternative Name: OTC (Ornithine carbamoyltransferase) (OTC Products)

Background: Ornithine transcarbamylase (OTC) (also called ornithine carbamoyltransferase) is an enzyme that catalyzes the reaction between carbamoyl phosphate (CP) and ornithine (Orn) to form citrulline (Cit) and phosphate (Pi). This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may also play a role in that disease.

UniProt: P00480