KRIT1 antibody (AA 703-736)

Catalog No. ABIN5647767

This Rabbit Polyclonal antibody specifically detects KRIT1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for KRIT1 antibody (AA 703-736) (ABIN5647767)

Target: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KRIT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KRIT1 Antibody

Binding Specificity: AA 703-736

Purification: Antigen affinity purified

Immunogen: Amino acids 703-736 (ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS) from the human protein were used as the immunogen for the KRIT1 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the KRIT1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for KRIT1

Target: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Alternative Name: KRIT1

Background: Krev interaction trapped protein 1 is a protein that in humans is encoded by the CCM1 gene. This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associated protein and may play a role in microtubule targeting. Mutations in this gene result in cerebral cavernous malformations. Multiple alternatively spliced transcript variants have been found for this gene.

UniProt: O00522

Pathways: Cell RedoxHomeostasis