ADAM28 antibody (AA 207-248)

Catalog No. ABIN5647843

The Rabbit Polyclonal anti-ADAM28 antibody has been validated for WB. It is suitable to detect ADAM28 in samples from Human.

Quick Overview for ADAM28 antibody (AA 207-248) (ABIN5647843)

Target: ADAM28 (ADAM Metallopeptidase Domain 28 (ADAM28))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAM28 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ADAM28 Antibody

Binding Specificity: AA 207-248

Purification: Antigen affinity purified

Immunogen: Amino acids 207-248 (EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH) from the human protein were used as the immunogen for the ADAM28 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ADAM28 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ADAM28 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ADAM28

Target: ADAM28 (ADAM Metallopeptidase Domain 28 (ADAM28))

Alternative Name: ADAM28

Background: Disintegrin and metalloproteinase domain-containing protein 28 is an enzyme that in humans is encoded by the ADAM28 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. And this gene is present in a gene cluster with other members of the ADAM family on chromosome 8. Alternative splicing results in multiple transcript variants.

UniProt: Q9UKQ2