Emerin antibody (N-Term)

Catalog No. ABIN5692852

Product Details anti-Emerin Antibody

Target: Emerin (EMD)

Binding Specificity: AA 1-48, N-Term

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This Emerin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))

Brand: Picoband™

Sequence: MDNYADLSDT ELTTLLRRYN IPHGPVVGST RRLYEKKIFE YETQRRRL

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Mouse IgG monoclonal antibody for Emerin detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1-48aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino ac

Clone: 5A10

Isotype: IgG1

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL
Immunohistochemistry(Frozen Section), 0.5-1 μg/mL
Immunocytochemistry, 0.5-1 μg/mL
Flow Cytometry, 1-3 μg/1x10⁶ cells

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for Emerin

Target: Emerin (EMD)

Alternative Name: EMD (EMD Products)

Synonyms: fj58f01 antibody, wu:fj58f01 antibody, EMD antibody, Bocks antibody, Bocksbeutel antibody, CG9424 antibody, Dmel\\CG9424 antibody, emerin antibody, emd antibody, xemd1 antibody, xemerin2 antibody, xemd2 antibody, xemerin1 antibody, EDMD antibody, LEMD5 antibody, STA antibody, AW550900 antibody, Sta antibody, emerin antibody, emerin (Emery-Dreifuss muscular dystrophy) antibody, bocksbeutel antibody, emerin L homeolog antibody, emerin S homeolog antibody, EMD antibody, emd antibody, bocks antibody, emd.L antibody, emd.S antibody, Emd antibody

Background:

Synonyms: Emerin, EMD, EDMD, STA

Tissue Specificity: Skeletal muscle, heart, colon, testis, ovary and pancreas.

UniProt: P50402