SP6 antibody

Catalog No. ABIN5692945

Product Details anti-SP6 Antibody

Target: SP6 (Sp6 Transcription Factor (SP6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SP6 antibody is un-conjugated

Application: Western Blotting (WB)

Brand: Picoband™

Sequence: QPDMSHHYES WFRPTHPGAE DGSWWDLHPG TSWMDLPH

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for SP6 detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human SP6 (QPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPH).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for SP6

Target: SP6 (Sp6 Transcription Factor (SP6))

Alternative Name: SP6 (SP6 Products)

Synonyms: xsp6 antibody, MGC131081 antibody, EPFN antibody, EPIPROFIN antibody, KLF14 antibody, 1110025J03Rik antibody, AA591031 antibody, AI592962 antibody, Epfn antibody, Klf14 antibody, Sp6 transcription factor antibody, Sp5 transcription factor L homeolog antibody, trans-acting transcription factor 6 antibody, SP6 antibody, sp5.L antibody, Sp6 antibody

Background:

Synonyms: Transcription factor Sp6, Krueppel-like factor 14, SP6, KLF14

Tissue Specificity: Ubiquitous.

Background: SP6 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich sequences and related GT and CACCC boxes. By somatic cell hybrid analysis and FISH, he SP6 gene is mapped t to chromosome 17q21.3-q22.