SP6 antibody
-
- Target See all SP6 Antibodies
- SP6 (Sp6 Transcription Factor (SP6))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SP6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Brand
- Picoband™
- Sequence
- QPDMSHHYES WFRPTHPGAE DGSWWDLHPG TSWMDLPH
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Rabbit IgG polyclonal antibody for SP6 detection. Tested with WB in Human,Mouse,Rat.
- Immunogen
- A synthetic peptide corresponding to a sequence of human SP6 (QPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPH).
- Top Product
- Discover our top product SP6 Primary Antibody
-
-
- Application Notes
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
Application Details: Western blot, 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SP6 (Sp6 Transcription Factor (SP6))
- Alternative Name
- SP6 (SP6 Products)
- Synonyms
- xsp6 antibody, MGC131081 antibody, EPFN antibody, EPIPROFIN antibody, KLF14 antibody, 1110025J03Rik antibody, AA591031 antibody, AI592962 antibody, Epfn antibody, Klf14 antibody, Sp6 transcription factor antibody, Sp5 transcription factor L homeolog antibody, trans-acting transcription factor 6 antibody, SP6 antibody, sp5.L antibody, Sp6 antibody
- Background
-
Synonyms: Transcription factor Sp6, Krueppel-like factor 14, SP6, KLF14
Tissue Specificity: Ubiquitous.
Background: SP6 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich sequences and related GT and CACCC boxes. By somatic cell hybrid analysis and FISH, he SP6 gene is mapped t to chromosome 17q21.3-q22.
-