Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

DC-SIGN/CD209 antibody

CD209 Reactivity: Human, Mouse, Rat WB, FACS, IHC, ICC, IHC (fro) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5693101
  • Target See all DC-SIGN/CD209 (CD209) Antibodies
    DC-SIGN/CD209 (CD209) (CD209)
    Reactivity
    • 97
    • 26
    • 21
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 70
    • 40
    • 4
    • 1
    Rabbit
    Clonality
    • 69
    • 46
    Polyclonal
    Conjugate
    • 59
    • 8
    • 8
    • 5
    • 5
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This DC-SIGN/CD209 antibody is un-conjugated
    Application
    • 67
    • 45
    • 31
    • 29
    • 24
    • 13
    • 7
    • 6
    • 6
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))
    Brand
    Picoband™
    Sequence
    MSDSKEPRLQ QLGLLEEEQL RGLGFRQTRG YKSLA
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for DC-SIGN detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.
    Immunogen
    A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA).
    Top Product
    Discover our top product CD209 Primary Antibody
  • Application Notes

    Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

    Application Details: Western blot, 0.1-0.5 μg/mL
    Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL
    Immunohistochemistry(Frozen Section), 0.5-1 μg/mL, Human
    Immunocytochemistry, 0.5-1 μg/mL, Human
    Flow Cytometry, 1-3 μg/1x106 cells, Human

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Buffer
    Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
  • Target
    DC-SIGN/CD209 (CD209) (CD209)
    Alternative Name
    CD209 (CD209 Products)
    Background

    Synonyms: CD209 antigen, C-type lectin domain family 4 member L, Dendritic cell-specific ICAM-3-grabbing non-integrin 1, DC-SIGN, DC-SIGN1, CD209, CD209, CLEC4L

    Tissue Specificity: Predominantly expressed in dendritic cells and in DC-residing tissues. Also found in placental macrophages, endothelial cells of placental vascular channels, peripheral blood mononuclear cells, and THP-1 monocytes.

    Background: DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin) also known as CD209 (Cluster of Differentiation 209) is a protein which in humans is encoded by the CD209 gene. This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene. DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.

You are here:
Support