CPA antibody

Catalog No. ABIN5708326

This anti-CPA antibody is a Rabbit Polyclonal antibody detecting CPA in WB. Suitable for Mouse and Rat.

Quick Overview for CPA antibody (ABIN5708326)

Target: CPA (Carboxypeptidase A (CPA))

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPA antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CPA Antibody

Cross-Reactivity (Details): Expected species reactivity: Human

Purification: Antigen affinity purified

Immunogen: Amino acids KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLD from the human protein were used as the immunogen for the Carboxypeptidase A antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Carboxypeptidase A antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Carboxypeptidase A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for CPA

Target: CPA (Carboxypeptidase A (CPA))

Alternative Name: Carboxypeptidase A

Background: Carboxypeptidase A1 is an enzyme that in humans is encoded by the CPA1 gene. This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. This enzyme is produced in the pancreas and preferentially cleaves C-terminal branched-chain and aromatic amino acids from dietary proteins. This gene and several family members are present in a gene cluster on chromosome 7. Mutations in this gene may be linked to chronic pancreatitis, while elevated protein levels may be associated with pancreatic cancer.

UniProt: P15085