NR1I3 antibody (N-Term)

Catalog No. ABIN629575

This Rabbit Polyclonal antibody specifically detects NR1I3 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for NR1I3 antibody (N-Term) (ABIN629575)

Target: NR1I3 (Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR1I3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-NR1I3 Antibody

Binding Specificity: N-Term

Specificity: NR1 I3 antibody was raised against the N terminal of NR1 3

Purification: Purified

Immunogen: NR1 I3 antibody was raised using the N terminal of NR1 3 corresponding to a region with amino acids MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NR1I3 Blocking Peptide, (ABIN5615048), is also available for use as a blocking control in assays to test for specificity of this NR1I3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NR1I3

Target: NR1I3 (Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3))

Alternative Name: NR1I3

Background: NR1I3 mediates the induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway