ECHDC3 antibody (N-Term)

Catalog No. ABIN629586

This anti-ECHDC3 antibody is a Rabbit Polyclonal antibody detecting ECHDC3 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for ECHDC3 antibody (N-Term) (ABIN629586)

Target: ECHDC3 (Enoyl CoA Hydratase Domain Containing 3 (ECHDC3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ECHDC3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ECHDC3 Antibody

Binding Specificity: N-Term

Specificity: ECHDC3 antibody was raised against the N terminal of ECHDC3

Purification: Purified

Immunogen: ECHDC3 antibody was raised using the N terminal of ECHDC3 corresponding to a region with amino acids SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ECHDC3 Blocking Peptide, (ABIN5613296), is also available for use as a blocking control in assays to test for specificity of this ECHDC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ECHDC3

Target: ECHDC3 (Enoyl CoA Hydratase Domain Containing 3 (ECHDC3))

Alternative Name: ECHDC3

Background: ECHDC3 possesses catalytic activity.

Molecular Weight: 40 kDa (MW of target protein)