PHACS antibody
-
- Target See all PHACS (ACCS) Antibodies
- PHACS (ACCS) (ACC Synthase-Like Protein 1 (ACCS))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PHACS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- PHACS antibody was raised using a synthetic peptide corresponding to a region with amino acids RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC
- Top Product
- Discover our top product ACCS Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PHACS Blocking Peptide, catalog no. 33R-8217, is also available for use as a blocking control in assays to test for specificity of this PHACS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHACS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHACS (ACCS) (ACC Synthase-Like Protein 1 (ACCS))
- Alternative Name
- PHACS (ACCS Products)
- Synonyms
- ACS antibody, PHACS antibody, 2610203E10Rik antibody, Phacs antibody, RGD1309314 antibody, fa10f06 antibody, wu:fa10f06 antibody, zgc:113217 antibody, 1-aminocyclopropane-1-carboxylate synthase homolog (inactive) antibody, 1-aminocyclopropane-1-carboxylate synthase (non-functional) antibody, 1-aminocyclopropane-1-carboxylate synthase homolog antibody, 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) antibody, ACCS antibody, Accs antibody, accs antibody
- Background
- PHACS does not catalyze the synthesis of 1-aminocyclopropane-1-carboxylate but is capable of catalyzing the deamination of L-vinylglycine.
- Molecular Weight
- 42 kDa (MW of target protein)
-