METTL7A antibody (N-Term)

Catalog No. ABIN629594

The Rabbit Polyclonal anti-METTL7A antibody has been validated for WB. It is suitable to detect METTL7A in samples from Human and Rat.

Quick Overview for METTL7A antibody (N-Term) (ABIN629594)

Target: METTL7A (Methyltransferase Like 7A (METTL7A))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This METTL7A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-METTL7A Antibody

Binding Specificity: N-Term

Specificity: METTL7 A antibody was raised against the N terminal of METTL7

Purification: Purified

Immunogen: METTL7 A antibody was raised using the N terminal of METTL7 corresponding to a region with amino acids MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPN

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

METTL7A Blocking Peptide, (ABIN5614733), is also available for use as a blocking control in assays to test for specificity of this METTL7A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for METTL7A

Target: METTL7A (Methyltransferase Like 7A (METTL7A))

Alternative Name: METTL7A

Background: METTL7A is thought to be a methyltransferase enzyme.

Molecular Weight: 20 kDa (MW of target protein)