TCP10L antibody

Catalog No. ABIN629595

The Rabbit Polyclonal anti-TCP10L antibody (ABIN629595) specifically detects TCP10L in IHC and WB. The antibody is reactive with Human samples.

Quick Overview for TCP10L antibody (ABIN629595)

Target: TCP10L (T-Complex 10-Like (TCP10L))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TCP10L antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Product Details anti-TCP10L Antibody

Purification: Purified

Immunogen: TCP10 L antibody was raised using a synthetic peptide corresponding to a region with amino acids ASPHAGQESHTLALEPAFGKISPLSADEETIPKYAGHKNQSATLLGQRSS

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TCP10L Blocking Peptide, (ABIN936906), is also available for use as a blocking control in assays to test for specificity of this TCP10L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TCP10L

Target: TCP10L (T-Complex 10-Like (TCP10L))

Alternative Name: TCP10L

Background: TCP10L is a human leucine zipper protein with transcription inhibition activity.

Molecular Weight: 24 kDa (MW of target protein)