NAMPT antibody (C-Term)

Catalog No. ABIN629601

This anti-NAMPT antibody is a Rabbit Polyclonal antibody detecting NAMPT in WB and IHC. Suitable for Human, Rat, Mouse and Dog.

Quick Overview for NAMPT antibody (C-Term) (ABIN629601)

Target: NAMPT (Nicotinamide phosphoribosyltransferase (NAMPT))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NAMPT antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-NAMPT Antibody

Binding Specificity: C-Term

Specificity: PBEF1 antibody was raised against the C terminal of PBEF1

Purification: Purified

Immunogen: PBEF1 antibody was raised using the C terminal of PBEF1 corresponding to a region with amino acids VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PBEF1 Blocking Peptide, catalog no. 33R-9851, is also available for use as a blocking control in assays to test for specificity of this PBEF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PBEF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NAMPT

Target: NAMPT (Nicotinamide phosphoribosyltransferase (NAMPT))

Alternative Name: PBEF1

Background: PBEF1 catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein is an adipokine that is localized to the bloodstream and has various functions, including the promotion of vascular smooth muscle cell maturation and inhibition of neutrophil apoptosis. It also activates insulin receptor and has insulin-mimetic effects, lowering blood glucose and improving insulin sensitivity. The protein is highly expressed in visceral fat and serum levels of the protein correlate with obesity.

Molecular Weight: 54 kDa (MW of target protein)