CTP Synthase antibody (N-Term)

Catalog No. ABIN629603

The Rabbit Polyclonal anti-CTP Synthase antibody has been validated for WB and IHC. It is suitable to detect CTP Synthase in samples from Human, Mouse and Rat.

Quick Overview for CTP Synthase antibody (N-Term) (ABIN629603)

Target: CTP Synthase (CTPS)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CTP Synthase antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-CTP Synthase Antibody

Binding Specificity: N-Term

Specificity: Ctp Synthase antibody was raised against the N terminal of CTPS

Purification: Purified

Immunogen: Ctp Synthase antibody was raised using the N terminal of CTPS corresponding to a region with amino acids SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Ctp Synthase Blocking Peptide, (ABIN5613028), is also available for use as a blocking control in assays to test for specificity of this Ctp Synthase antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTPS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CTP Synthase

Target: CTP Synthase (CTPS)

Alternative Name: Ctp Synthase

Background: The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development and tumorigenesis.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: Proton Transport, Ribonucleoside Biosynthetic Process