CENPA antibody (N-Term)

Catalog No. ABIN629608

This Rabbit Polyclonal antibody specifically detects CENPA in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for CENPA antibody (N-Term) (ABIN629608)

Target: CENPA (Centromere Protein A (CENPA))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CENPA antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-CENPA Antibody

Binding Specificity: N-Term

Specificity: CENPA antibody was raised against the N terminal of CENPA

Purification: Purified

Immunogen: CENPA antibody was raised using the N terminal of CENPA corresponding to a region with amino acids MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CENPA Blocking Peptide, (ABIN5612817), is also available for use as a blocking control in assays to test for specificity of this CENPA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CENPA

Target: CENPA (Centromere Protein A (CENPA))

Alternative Name: CENPA

Background: Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA is a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: Chromatin Binding, Maintenance of Protein Location