PEBP1 antibody (C-Term)

Catalog No. ABIN629609

The Rabbit Polyclonal anti-PEBP1 antibody has been validated for WB. It is suitable to detect PEBP1 in samples from Human and Mouse.

Quick Overview for PEBP1 antibody (C-Term) (ABIN629609)

Target: PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PEBP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PEBP1 Antibody

Binding Specificity: C-Term

Specificity: PEBP1 antibody was raised against the C terminal of PEBP1

Purification: Purified

Immunogen: PEBP1 antibody was raised using the C terminal of PEBP1 corresponding to a region with amino acids LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PEBP1 Blocking Peptide, catalog no. 33R-5442, is also available for use as a blocking control in assays to test for specificity of this PEBP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PEBP1

Target: PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))

Alternative Name: PEBP1

Background: PEBP1 binds ATP, opioids and phosphatidylethanolamine. It has lower affinity for phosphatidylinositol and phosphatidylcholine. It is also a serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: Feeding Behaviour