PEBP1 antibody (C-Term)
-
- Target See all PEBP1 Antibodies
- PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PEBP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PEBP1 antibody was raised against the C terminal of PEBP1
- Purification
- Purified
- Immunogen
- PEBP1 antibody was raised using the C terminal of PEBP1 corresponding to a region with amino acids LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
- Top Product
- Discover our top product PEBP1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PEBP1 Blocking Peptide, catalog no. 33R-5442, is also available for use as a blocking control in assays to test for specificity of this PEBP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEBP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))
- Alternative Name
- PEBP1 (PEBP1 Products)
- Synonyms
- HCNP antibody, HCNPpp antibody, PBP antibody, PEBP antibody, PEBP-1 antibody, RKIP antibody, pbp antibody, hcnp antibody, pebp antibody, rkip antibody, Pbp antibody, Pbp1 antibody, Pbpr antibody, Rkip antibody, PEBP1 antibody, BcDNA:LP12095 antibody, CG18594 antibody, Dmel\\CG18594 antibody, T2 antibody, zgc:56033 antibody, zgc:76942 antibody, phosphatidylethanolamine binding protein 1 antibody, phosphatidylethanolamine binding protein 1 L homeolog antibody, phosphatidylethanolamine-binding protein antibody, phosphatidylethanolamine-binding protein,putative antibody, Phosphatidylethanolamine-binding protein 1 antibody, PEBP1 antibody, pebp1 antibody, Pebp1 antibody, pebp1.L antibody, RR_RS07785 antibody, PVX_235290 antibody, PVX_123630 antibody, PKH_143640 antibody, EAM_1207 antibody
- Background
- PEBP1 binds ATP, opioids and phosphatidylethanolamine. It has lower affinity for phosphatidylinositol and phosphatidylcholine. It is also a serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.
- Molecular Weight
- 21 kDa (MW of target protein)
- Pathways
- Feeding Behaviour
-