PRP19 antibody

Catalog No. ABIN629622

This anti-PRP19 antibody is a Rabbit Polyclonal antibody detecting PRP19 in WB and IHC. Suitable for Human, Mouse, Rat, Dog and Zebrafish (Danio rerio).

Quick Overview for PRP19 antibody (ABIN629622)

Target: PRP19 (PRPF19) (Pre-mRNA Processing Factor 19 (PRPF19))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRP19 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PRP19 Antibody

Purification: Purified

Immunogen: PRPF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRPF19 Blocking Peptide, (ABIN5615578), is also available for use as a blocking control in assays to test for specificity of this PRPF19 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRP19

Target: PRP19 (PRPF19) (Pre-mRNA Processing Factor 19 (PRPF19))

Alternative Name: PRPF19

Background: PRPF19 plays a role in DNA double-strand break (DSB) repair and pre-mRNA splicing reaction. It binds double-stranded DNA in a sequence-nonspecific manner. PRPF19 acts as a structural component of the nuclear framework. It may also serve as a support for spliceosome binding and activity. It is essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. It also may have E3 ubiquitin ligase activity.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization