EIF2S3 antibody (N-Term)

Catalog No. ABIN629631

This anti-EIF2S3 antibody is a Rabbit Polyclonal antibody detecting EIF2S3 in WB. Suitable for Human, Rat, Mouse, Dog and Zebrafish (Danio rerio).

Quick Overview for EIF2S3 antibody (N-Term) (ABIN629631)

Target: EIF2S3 (Eukaryotic Translation Initiation Factor 2, Subunit 3 Gamma, 52kDa (EIF2S3))

Reactivity: Human, Rat, Mouse, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF2S3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EIF2S3 Antibody

Binding Specificity: N-Term

Specificity: EIF2 S3 antibody was raised against the N terminal of EIF2 3

Purification: Purified

Immunogen: EIF2 S3 antibody was raised using the N terminal of EIF2 3 corresponding to a region with amino acids LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF2S3 Blocking Peptide, (ABIN940227), is also available for use as a blocking control in assays to test for specificity of this EIF2S3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF2S3

Target: EIF2S3 (Eukaryotic Translation Initiation Factor 2, Subunit 3 Gamma, 52kDa (EIF2S3))

Alternative Name: EIF2S3

Background: EIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.

Molecular Weight: 51 kDa (MW of target protein)