WDR12 antibody (C-Term)

Catalog No. ABIN629636

The Rabbit Polyclonal anti-WDR12 antibody has been validated for WB. It is suitable to detect WDR12 in samples from Human, Mouse, Rat and Dog.

Quick Overview for WDR12 antibody (C-Term) (ABIN629636)

Target: WDR12 (WD Repeat Domain 12 (WDR12))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-WDR12 Antibody

Binding Specificity: C-Term

Specificity: WDR12 antibody was raised against the C terminal of WDR12

Purification: Purified

Immunogen: WDR12 antibody was raised using the C terminal of WDR12 corresponding to a region with amino acids DTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTSH

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR12 Blocking Peptide, (ABIN937595), is also available for use as a blocking control in assays to test for specificity of this WDR12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR12

Target: WDR12 (WD Repeat Domain 12 (WDR12))

Alternative Name: WDR12

Background: WDR12 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. The function of this protein is not known.

Molecular Weight: 47 kDa (MW of target protein)