FAM107A antibody (Middle Region)

Catalog No. ABIN629643

The Rabbit Polyclonal anti-FAM107A antibody (ABIN629643) specifically detects FAM107A in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for FAM107A antibody (Middle Region) (ABIN629643)

Target: FAM107A (Family with Sequence Similarity 107, Member A (FAM107A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM107A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAM107A Antibody

Binding Specificity: Middle Region

Specificity: FAM107 A antibody was raised against the middle region of FAM107

Purification: Purified

Immunogen: FAM107 A antibody was raised using the middle region of FAM107 corresponding to a region with amino acids RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE

Application Details

Application Notes: WB: 0.0625 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM107A Blocking Peptide, (ABIN5613460), is also available for use as a blocking control in assays to test for specificity of this FAM107A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM100 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM107A

Target: FAM107A (Family with Sequence Similarity 107, Member A (FAM107A))

Alternative Name: FAM107A

Background: When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development.

Molecular Weight: 17 kDa (MW of target protein)