PCMTD1 antibody

Catalog No. ABIN629648

The Rabbit Polyclonal anti-PCMTD1 antibody has been validated for WB. It is suitable to detect PCMTD1 in samples from Human, Mouse and Rat.

Quick Overview for PCMTD1 antibody (ABIN629648)

Target: PCMTD1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase Domain Containing 1 (PCMTD1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCMTD1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PCMTD1 Antibody

Purification: Purified

Immunogen: PCMTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIY

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCMTD1 Blocking Peptide, (ABIN5615259), is also available for use as a blocking control in assays to test for specificity of this PCMTD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCMTD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCMTD1

Target: PCMTD1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase Domain Containing 1 (PCMTD1))

Alternative Name: PCMTD1

Background: The function of PCMTD1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 41 kDa (MW of target protein)