UPB1 antibody (Middle Region)

Catalog No. ABIN629651

The Rabbit Polyclonal anti-UPB1 antibody has been validated for WB. It is suitable to detect UPB1 in samples from Human, Mouse, Rat, Dog, Zebrafish (Danio rerio), Drosophila melanogaster, Arabidopsis and C. elegans.

Quick Overview for UPB1 antibody (Middle Region) (ABIN629651)

Target: UPB1 (Ureidopropionase, beta (UPB1))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio), Drosophila melanogaster, Arabidopsis, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UPB1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UPB1 Antibody

Binding Specificity: Middle Region

Specificity: UPB1 antibody was raised against the middle region of UPB1

Purification: Purified

Immunogen: UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAV

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UPB1 Blocking Peptide, (ABIN937005), is also available for use as a blocking control in assays to test for specificity of this UPB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UPB1

Target: UPB1 (Ureidopropionase, beta (UPB1))

Alternative Name: UPB1

Background: UPB1 is a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activity.

Molecular Weight: 42 kDa (MW of target protein)