ACAT2 antibody
-
- Target See all ACAT2 Antibodies
- ACAT2 (Acetyl-CoA Acetyltransferase 2 (ACAT2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACAT2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- ACAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMS
- Top Product
- Discover our top product ACAT2 Primary Antibody
-
-
- Application Notes
-
WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACAT2 Blocking Peptide, catalog no. 33R-9686, is also available for use as a blocking control in assays to test for specificity of this ACAT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACAT2 (Acetyl-CoA Acetyltransferase 2 (ACAT2))
- Alternative Name
- ACAT2 (ACAT2 Products)
- Background
- Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 genehows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.
- Molecular Weight
- 44 kDa (MW of target protein)
-