ACAT2 antibody

Catalog No. ABIN629656

This Rabbit Polyclonal antibody specifically detects ACAT2 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for ACAT2 antibody (ABIN629656)

Target: ACAT2 (Acetyl-CoA Acetyltransferase 2 (ACAT2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACAT2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-ACAT2 Antibody

Purification: Purified

Immunogen: ACAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMS

Application Details

Application Notes: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACAT2 Blocking Peptide, (ABIN5611885), is also available for use as a blocking control in assays to test for specificity of this ACAT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACAT2

Target: ACAT2 (Acetyl-CoA Acetyltransferase 2 (ACAT2))

Alternative Name: ACAT2

Background: Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 genehows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.

Molecular Weight: 44 kDa (MW of target protein)