Adenylate Kinase 2 antibody (N-Term)

Catalog No. ABIN629660

The Rabbit Polyclonal anti-Adenylate Kinase 2 antibody has been validated for WB. It is suitable to detect Adenylate Kinase 2 in samples from Human.

Quick Overview for Adenylate Kinase 2 antibody (N-Term) (ABIN629660)

Target: Adenylate Kinase 2 (AK2)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Adenylate Kinase 2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Adenylate Kinase 2 Antibody

Binding Specificity: N-Term

Specificity: AK2 antibody was raised against the N terminal of AK2

Purification: Purified

Immunogen: AK2 antibody was raised using the N terminal of AK2 corresponding to a region with amino acids MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDML

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AK2 Blocking Peptide, (ABIN5611983), is also available for use as a blocking control in assays to test for specificity of this AK2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Adenylate Kinase 2

Target: Adenylate Kinase 2 (AK2)

Alternative Name: AK2

Background: Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process