CROT antibody (N-Term)
-
- Target See all CROT Antibodies
- CROT (Carnitine O-Octanoyltransferase (CROT))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CROT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CROT antibody was raised against the N terminal of CROT
- Purification
- Purified
- Immunogen
- CROT antibody was raised using the N terminal of CROT corresponding to a region with amino acids MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKK
- Top Product
- Discover our top product CROT Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CROT Blocking Peptide, catalog no. 33R-5938, is also available for use as a blocking control in assays to test for specificity of this CROT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CROT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CROT (Carnitine O-Octanoyltransferase (CROT))
- Alternative Name
- CROT (CROT Products)
- Background
- Carnitine octanoyltransferase is a carnitine acyltransferase that catalyzes the reversible transfer of fatty acyl groups between CoA and carnitine. This provides a crucial step in the transport of medium- and long-chain acyl-CoA out of the mammalian peroxisome to the cytosol and mitochondria.
- Molecular Weight
- 70 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-