MDH1 antibody

Catalog No. ABIN629689

This Rabbit Polyclonal antibody specifically detects MDH1 in WB. It exhibits reactivity toward Human, Mouse, Rat and Arabidopsis.

Quick Overview for MDH1 antibody (ABIN629689)

Target: MDH1 (Malate Dehydrogenase 1, NAD (Soluble) (MDH1))

Reactivity: Human, Mouse, Rat, Arabidopsis

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MDH1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MDH1 Antibody

Purification: Purified

Immunogen: MDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MDH1 Blocking Peptide, catalog no. 33R-6690, is also available for use as a blocking control in assays to test for specificity of this MDH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MDH1

Target: MDH1 (Malate Dehydrogenase 1, NAD (Soluble) (MDH1))

Alternative Name: MDH1

Background: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.

Molecular Weight: 36 kDa (MW of target protein)