MDH1 antibody
-
- Target See all MDH1 Antibodies
- MDH1 (Malate Dehydrogenase 1, NAD (Soluble) (MDH1))
-
Reactivity
- Human, Mouse, Rat, Arabidopsis
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MDH1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- MDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV
- Top Product
- Discover our top product MDH1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MDH1 Blocking Peptide, catalog no. 33R-6690, is also available for use as a blocking control in assays to test for specificity of this MDH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MDH1 (Malate Dehydrogenase 1, NAD (Soluble) (MDH1))
- Alternative Name
- MDH1 (MDH1 Products)
- Synonyms
- MDH-s antibody, MDHA antibody, MGC:1375 antibody, MOR2 antibody, ODS1 antibody, B230377B03Rik antibody, D17921 antibody, Mor-2 antibody, Mor2 antibody, MDL1 antibody, Mdhl antibody, MDH antibody, mdh-s antibody, mdha antibody, mor2 antibody, MDH-1 antibody, Mdh antibody, Mdh-1 antibody, Mdh2 antibody, MdhD antibody, cMdh antibody, sMdh antibody, malate dehydrogenase 1 antibody, malic enzyme 2 antibody, malate dehydrogenase 1, NAD (soluble) antibody, malate dehydrogenase 1 S homeolog antibody, malate dehydrogenase, cytoplasmic antibody, Malate dehydrogenase 1 antibody, MDH1 antibody, ME2 antibody, Mdh1 antibody, mdh1.S antibody, LOC100280767 antibody
- Background
- Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.
- Molecular Weight
- 36 kDa (MW of target protein)
-