PPIF antibody

Catalog No. ABIN629692

This Rabbit Polyclonal antibody specifically detects PPIF in WB. It exhibits reactivity toward Human, Rat and Dog.

Quick Overview for PPIF antibody (ABIN629692)

Target: PPIF (Peptidylprolyl Isomerase F (PPIF))

Reactivity: Human, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPIF antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PPIF Antibody

Purification: Purified

Immunogen: PPIF antibody was raised using a synthetic peptide corresponding to a region with amino acids GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPIF Blocking Peptide, (ABIN938975), is also available for use as a blocking control in assays to test for specificity of this PPIF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPIF

Target: PPIF (Peptidylprolyl Isomerase F (PPIF))

Alternative Name: PPIF

Background: PPIF is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.

Molecular Weight: 19 kDa (MW of target protein)

Pathways: Proton Transport, Negative Regulation of intrinsic apoptotic Signaling, Negative Regulation of Transporter Activity