ASS1 antibody (N-Term)
-
- Target See all ASS1 Antibodies
- ASS1 (Argininosuccinate Synthase 1 (ASS1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ASS1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ASS1 antibody was raised against the N terminal Of Ass
- Purification
- Purified
- Immunogen
- ASS1 antibody was raised using the N terminal Of Ass corresponding to a region with amino acids YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF
- Top Product
- Discover our top product ASS1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ASS1 Blocking Peptide, catalog no. 33R-10240, is also available for use as a blocking control in assays to test for specificity of this ASS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASS1 (Argininosuccinate Synthase 1 (ASS1))
- Alternative Name
- ASS1 (ASS1 Products)
- Synonyms
- ASS antibody, CTLN1 antibody, AA408052 antibody, Ass-1 antibody, fold antibody, ASSA antibody, Ass antibody, ass antibody, zgc:92051 antibody, wu:fb95a04 antibody, wu:fc01e08 antibody, argininosuccinate synthase 1 antibody, argininosuccinate synthetase 1 antibody, argininosuccinate synthase 1 S homeolog antibody, ASS1 antibody, Ass1 antibody, ass1.S antibody, ass1 antibody
- Background
- ASS catalyzes the penultimate step of the arginine biosynthetic pathway.
- Molecular Weight
- 45 kDa (MW of target protein)
- Pathways
- Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin
-