ASS1 antibody (N-Term)

Catalog No. ABIN629706

Product Details anti-ASS1 Antibody

Target: ASS1 (Argininosuccinate Synthase 1 (ASS1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASS1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ASS1 antibody was raised against the N terminal Of Ass

Purification: Purified

Immunogen: ASS1 antibody was raised using the N terminal Of Ass corresponding to a region with amino acids YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASS1 Blocking Peptide, catalog no. 33R-10240, is also available for use as a blocking control in assays to test for specificity of this ASS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASS1

Target: ASS1 (Argininosuccinate Synthase 1 (ASS1))

Alternative Name: ASS1 (ASS1 Products)

Synonyms: ASS antibody, CTLN1 antibody, AA408052 antibody, Ass-1 antibody, fold antibody, ASSA antibody, Ass antibody, ass antibody, zgc:92051 antibody, wu:fb95a04 antibody, wu:fc01e08 antibody, argininosuccinate synthase 1 antibody, argininosuccinate synthetase 1 antibody, argininosuccinate synthase 1 S homeolog antibody, ASS1 antibody, Ass1 antibody, ass1.S antibody, ass1 antibody

Background: ASS catalyzes the penultimate step of the arginine biosynthetic pathway.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin