ATP7A antibody

Catalog No. ABIN629724

Product Details anti-ATP7A Antibody

Target: ATP7A (ATPase, Cu++ Transporting, alpha Polypeptide (ATP7A))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP7A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: ATP7 A antibody was raised using a synthetic peptide corresponding to a region with amino acids MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP7A

Target: ATP7A (ATPase, Cu++ Transporting, alpha Polypeptide (ATP7A))

Alternative Name: ATP7A (ATP7A Products)

Background: The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Golgi compartment and effluxes excess copper. The trafficking mechanism and catalytic activity combine to facilitate absorption and intercellular transport of copper. Menkes disease, a systemic copper deficiency disorder, is caused by mutations in the ATP7A gene.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Ribonucleoside Biosynthetic Process