BSDC1 antibody (N-Term)

Catalog No. ABIN629726

The Rabbit Polyclonal anti-BSDC1 antibody has been validated for WB and IHC. It is suitable to detect BSDC1 in samples from Human, Mouse, Dog, Rat and Zebrafish (Danio rerio).

Quick Overview for BSDC1 antibody (N-Term) (ABIN629726)

Target: BSDC1 (BSD Domain Containing 1 (BSDC1))

Reactivity: Human, Mouse, Dog, Rat, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BSDC1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-BSDC1 Antibody

Binding Specificity: N-Term

Specificity: BSDC1 antibody was raised against the N terminal of BSDC1

Purification: Purified

Immunogen: BSDC1 antibody was raised using the N terminal of BSDC1 corresponding to a region with amino acids VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BSDC1 Blocking Peptide, (ABIN5612370), is also available for use as a blocking control in assays to test for specificity of this BSDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BSDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BSDC1

Target: BSDC1 (BSD Domain Containing 1 (BSDC1))

Alternative Name: BSDC1

Background: BSDC1 may be involved in protein binding.

Molecular Weight: 17 kDa (MW of target protein)